MLC1SA monoclonal antibody (M01), clone 4G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MLC1SA monoclonal antibody (M01), clone 4G11 Western Blot analysis of MLC1SA expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL6B is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MLC1SA.
Immunogen
MLC1SA (NP_002466, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MLC1SA monoclonal antibody (M01), clone 4G11 Western Blot analysis of MLC1SA expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL6B is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — MYL6B
Entrez GeneID
140465GeneBank Accession#
NM_002475Protein Accession#
NP_002466Gene Name
MYL6B
Gene Alias
MLC1SA
Gene Description
myosin, light chain 6B, alkali, smooth muscle and non-muscle
Omim ID
609930Gene Ontology
HyperlinkGene Summary
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq
Other Designations
myosin alkali light chain 1 slow a|myosin light chain 1 slow a|myosin light chain 1, slow-twitch muscle A isoform|myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle|smooth muscle and non-muscle myosin alkali light chain 6B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com