Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL6B purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00140465-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MYL6B protein.
  • Immunogen:
  • MYL6B (NP_002466.1, 1 a.a. ~ 208 a.a) full-length human protein.
  • Sequence:
  • MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MYL6B expression in transfected 293T cell line (H00140465-T01) by MYL6B MaxPab polyclonal antibody.

    Lane 1: MLC1SA transfected lysate(22.88 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MYL6B
  • Gene Alias:
  • MLC1SA
  • Gene Description:
  • myosin, light chain 6B, alkali, smooth muscle and non-muscle
  • Gene Summary:
  • Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq
  • Other Designations:
  • myosin alkali light chain 1 slow a,myosin light chain 1 slow a,myosin light chain 1, slow-twitch muscle A isoform,myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle,smooth muscle and non-muscle myosin alkali light chain 6B
  • RSS
  • YouTube
  • Linkedin
  • Facebook