ASB5 monoclonal antibody (M03), clone 6B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ASB5 monoclonal antibody (M03), clone 6B10. Western Blot analysis of ASB5 expression in NIH/3T3.
Western Blot (Transfected lysate)
Western Blot analysis of ASB5 expression in transfected 293T cell line by ASB5 monoclonal antibody (M03), clone 6B10.
Lane 1: ASB5 transfected lysate (Predicted MW: 36.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASB5 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ASB5.
Immunogen
ASB5 (NP_543150, 220 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQY
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ASB5 monoclonal antibody (M03), clone 6B10. Western Blot analysis of ASB5 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of ASB5 expression in transfected 293T cell line by ASB5 monoclonal antibody (M03), clone 6B10.
Lane 1: ASB5 transfected lysate (Predicted MW: 36.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASB5 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ASB5
Entrez GeneID
140458GeneBank Accession#
NM_080874Protein Accession#
NP_543150Gene Name
ASB5
Gene Alias
-
Gene Description
ankyrin repeat and SOCS box-containing 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but their full length sequences are not known. [provided by RefSeq
Other Designations
SOCS box protein ASB-5|ankyrin repeat and SOCS box-containing protein 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com