ASB11 monoclonal antibody (M01), clone 4D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASB11 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ASB11.
Immunogen
ASB11 (NP_543149, 214 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASB11 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ASB11
Entrez GeneID
140456GeneBank Accession#
NM_080873Protein Accession#
NP_543149Gene Name
ASB11
Gene Alias
DKFZp779E2460, MGC119168, MGC119169
Gene Description
ankyrin repeat and SOCS box-containing 11
Omim ID
300626Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022958|ankyrin repeat and SOCS box-containing protein 11|ankyrin repeat and SOCS box-containing protein 11, isoform a|ankyrin repeat domain-containing SOCS box protein ASB11
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com