Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C9orf23 (Human) Recombinant Protein (P01)

  • Catalog # : H00138716-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C9orf23 full-length ORF ( NP_680544.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.00
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00138716-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • C9orf23
  • Gene Alias:
  • MGC29635,bA296L22.5
  • Gene Description:
  • chromosome 9 open reading frame 23
  • Gene Summary:
  • This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000513,OTTHUMP00000000514,hypothetical protein LOC138716
  • RSS
  • YouTube
  • Linkedin
  • Facebook