TAF1L (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAF1L partial ORF ( NP_722516, 1532 a.a. - 1641 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF1L
Entrez GeneID
138474GeneBank Accession#
NM_153809Protein Accession#
NP_722516Gene Name
TAF1L
Gene Alias
MGC134910, TAF2A2
Gene Description
TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
Omim ID
607798Gene Ontology
HyperlinkGene Summary
This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq
Other Designations
TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210 kD|TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa|TBP-associated factor RNA polymerase 1-like
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com