TAF1L monoclonal antibody (M01), clone 1E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TAF1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAF1L is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAF1L.
Immunogen
TAF1L (NP_722516, 1532 a.a. ~ 1641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TAF1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAF1L is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TAF1L
Entrez GeneID
138474GeneBank Accession#
NM_153809Protein Accession#
NP_722516Gene Name
TAF1L
Gene Alias
MGC134910, TAF2A2
Gene Description
TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
Omim ID
607798Gene Ontology
HyperlinkGene Summary
This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq
Other Designations
TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210 kD|TAF1-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa|TBP-associated factor RNA polymerase 1-like
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com