Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HGSNAT (Human) Recombinant Protein (P01)

  • Catalog # : H00138050-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HGSNAT full-length ORF ( AAH12452.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00138050-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HGSNAT
  • Gene Alias:
  • DKFZp686G24175,FLJ22242,FLJ32731,HGNAT,MPS3C,TMEM76
  • Gene Description:
  • heparan-alpha-glucosaminide N-acetyltransferase
  • Gene Summary:
  • This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq
  • Other Designations:
  • transmembrane protein 76
  • RSS
  • YouTube
  • Linkedin
  • Facebook