MTPN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MTPN expression in transfected 293T cell line (H00136319-T01) by MTPN MaxPab polyclonal antibody.
Lane1:MTPN transfected lysate(13.09 KDa).
Lane 2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MTPN protein.
Immunogen
MTPN (AAH28093, 1 a.a. ~ 118 a.a) full-length human protein.
Sequence
MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MTPN expression in transfected 293T cell line (H00136319-T01) by MTPN MaxPab polyclonal antibody.
Lane1:MTPN transfected lysate(13.09 KDa).
Lane 2:Non-transfected lysate.
-
Gene Info — MTPN
Entrez GeneID
136319GeneBank Accession#
BC028093Protein Accession#
AAH28093Gene Name
MTPN
Gene Alias
FLJ31098, FLJ99857, GCDP, V-1
Gene Description
myotrophin
Omim ID
606484Gene Ontology
HyperlinkGene Summary
The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq
Other Designations
granule cell differentiation protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com