PACRG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PACRG MaxPab rabbit polyclonal antibody. Western Blot analysis of PACRG expression in human liver.
Western Blot (Tissue lysate)
PACRG MaxPab rabbit polyclonal antibody. Western Blot analysis of PACRG expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of PACRG expression in transfected 293T cell line (H00135138-T02) by PACRG MaxPab polyclonal antibody.
Lane 1: PACRG transfected lysate(29.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PACRG protein.
Immunogen
PACRG (NP_001073847.1, 1 a.a. ~ 257 a.a) full-length human protein.
Sequence
MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PACRG MaxPab rabbit polyclonal antibody. Western Blot analysis of PACRG expression in human liver.Western Blot (Tissue lysate)
PACRG MaxPab rabbit polyclonal antibody. Western Blot analysis of PACRG expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of PACRG expression in transfected 293T cell line (H00135138-T02) by PACRG MaxPab polyclonal antibody.
Lane 1: PACRG transfected lysate(29.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PACRG
Entrez GeneID
135138GeneBank Accession#
BC044227.1Protein Accession#
NP_001073847.1Gene Name
PACRG
Gene Alias
FLJ32724, GLUP, HAK005771, PARK2CRG, RP3-495O10.2
Gene Description
PARK2 co-regulated
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000017729|OTTHUMP00000017730|molecular chaperone/chaperonin-binding protein|parkin co-regulated gene protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com