PACRG MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PACRG expression in transfected 293T cell line (H00135138-T01) by PACRG MaxPab polyclonal antibody.
Lane 1: PACRG transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PACRG protein.
Immunogen
PACRG (NP_001073847.1, 1 a.a. ~ 257 a.a) full-length human protein.
Sequence
MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PACRG expression in transfected 293T cell line (H00135138-T01) by PACRG MaxPab polyclonal antibody.
Lane 1: PACRG transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PACRG
Entrez GeneID
135138GeneBank Accession#
BC044227.1Protein Accession#
NP_001073847.1Gene Name
PACRG
Gene Alias
FLJ32724, GLUP, HAK005771, PARK2CRG, RP3-495O10.2
Gene Description
PARK2 co-regulated
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000017729|OTTHUMP00000017730|molecular chaperone/chaperonin-binding protein|parkin co-regulated gene protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com