WDR36 monoclonal antibody (M01), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WDR36.
Immunogen
WDR36 (NP_644810, 853 a.a. ~ 951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR36 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — WDR36
Entrez GeneID
134430GeneBank Accession#
NM_139281Protein Accession#
NP_644810Gene Name
WDR36
Gene Alias
DKFZp686I1650, GLC1G, TA-WDRP, TAWDRP, UTP21
Gene Description
WD repeat domain 36
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Mutations in this gene have been associated with adult-onset primary open-angle glaucoma (POAG). [provided by RefSeq
Other Designations
OTTHUMP00000158997|T-cell activation WD repeat protein
-
Interactome
-
Disease
-
Publication Reference
-
WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, G{alpha}q and phospholipase C{beta} in a signalling complex.
Cartier A, Parent A, Labrecque P, Laroche G, Parent JL.
Journal of Cell Science 2011 Oct; 124(Pt 19):3292.
Application:IF, WB-Tr, Human, HEK 293 cells.
-
Identification of early transcripts related to male development in chicken embryos.
Lin YP, Chen LR, Chen CF, Liou JF, Chen YL, Yang JR, Shiue YL.
Theriogenology 2010 Oct; 74(7):1161.
Application:WB-Ti, Chicken, Chicken gonad.
-
Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.
Human Molecular Genetics 2009 Apr; 18(7):1276.
Application:WB-Ce, Human, Monkey, Rat, COS-7, NPCE, HTM, RGC5 cells.
-
WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, G{alpha}q and phospholipase C{beta} in a signalling complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com