PPARGC1B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPARGC1B.
Immunogen
PPARGC1B (NP_573570, 914 a.a. ~ 1023 a.a) partial recombinant protein with GST tag.
Sequence
SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPARGC1B
Entrez GeneID
133522GeneBank Accession#
NM_133263Protein Accession#
NP_573570Gene Name
PPARGC1B
Gene Alias
ERRL1, PERC, PGC-1(beta), PGC1B
Gene Description
peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Gene Ontology
HyperlinkGene Summary
O
Other Designations
PGC-1-related estrogen receptor alpha coactivator|peroxisome proliferative activated receptor, gamma, coactivator 1, beta
-
Interactome
-
Disease
-
Publication Reference
-
Stimulatory effect of CSE-generated H2S on hepatic mitochondrial biogenesis and the underlying mechanisms.
Untereiner AA, Fu M, Modis K, Wang R, Ju Y, Wu L.
Nitric Oxide 2016 Aug; 58:67.
Application:WB-Ce, Mouse, Hepatocytes.
-
Increased Basal Level of Akt-Dependent Insulin Signaling May Be Responsible for the Development of Insulin Resistance.
Liu H, Hong T, Wen GB, Han J, Zhuo D, Liu Z, Cao W.
American Journal of Physiology. Endocrinology and Metabolism 2009 Oct; 297(4):E898.
Application:WB-Ti, Mouse, Gastrocnemius, Livers.
-
Rapid exercise-induced changes in PGC-1{alpha} mRNA and protein in human skeletal muscle.
Mathai AS, Bonen A, Benton CR, Robinson DL, Graham TE.
Journal of Applied Physiology 2008 Jul; 105(4):1098.
Application:WB, Human, Human muscle.
-
PGC1{alpha} relationship with skeletal muscle palmitate oxidation is not present with obesity, despite maintained ained PGC1{alpha} and PGC1{beta} protein.
Holloway GP, Perry CG, Thrush AB, Heigenhauser GJ, Dyck DJ, Bonen A, Spriet LL.
American Journal of Physiology. Endocrinology and Metabolism 2008 Mar; 294(6):E1060.
Application:WB, Human, Human skeletal muscle.
-
Stimulatory effect of CSE-generated H2S on hepatic mitochondrial biogenesis and the underlying mechanisms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com