Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPARGC1B polyclonal antibody (A01)

  • Catalog # : H00133522-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPARGC1B.
  • Immunogen:
  • PPARGC1B (NP_573570, 914 a.a. ~ 1023 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00133522-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PPARGC1B
  • Gene Alias:
  • ERRL1,PERC,PGC-1(beta),PGC1B
  • Gene Description:
  • peroxisome proliferator-activated receptor gamma, coactivator 1 beta
  • Other Designations:
  • PGC-1-related estrogen receptor alpha coactivator,peroxisome proliferative activated receptor, gamma, coactivator 1, beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook