OTOP1 monoclonal antibody (M02), clone 5E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OTOP1 monoclonal antibody (M02), clone 5E3. Western Blot analysis of OTOP1 expression in MCF-7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTOP1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OTOP1.
Immunogen
OTOP1 (NP_819056.1, 415 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEGHPRYTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPKSGGVARDVAPQGKDMPPAANGNVC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OTOP1 monoclonal antibody (M02), clone 5E3. Western Blot analysis of OTOP1 expression in MCF-7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OTOP1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — OTOP1
Entrez GeneID
133060GeneBank Accession#
NM_177998Protein Accession#
NP_819056.1Gene Name
OTOP1
Gene Alias
MGC163302, MGC163304
Gene Description
otopetrin 1
Omim ID
607806Gene Ontology
HyperlinkOther Designations
-
-
Publication Reference
-
Loss of Otopetrin 1 affects thermoregulation during fasting in mice.
Yu-Hsiang Tu, Naili Liu, Cuiying Xiao, Oksana Gavrilova, Marc L Reitman.
PLoS One 2023 Oct; 18(10):e0292610.
Application：WB, Mouse, Mouse brown adipose tissue.
-
Loss of Otopetrin 1 affects thermoregulation during fasting in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com