Product Browser

Last updated: 2020/4/5

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AASDH DNAxPab DNAxPab

  • Catalog # : H00132949-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human AASDH DNA using DNAx™ Immune technology.
  • Immunogen:
  • Full-length human DNA
  • Sequence:
  • MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Gene Name:
  • AASDH
  • Gene Alias:
  • ACSF4,LYS2,NRPS1098,NRPS998
  • Gene Description:
  • aminoadipate-semialdehyde dehydrogenase
  • Other Designations:
  • 2-aminoadipic 6-semialdehyde dehydrogenase,acyl-CoA synthetase family member 4,non-ribosomal peptide synthetase 1098,non-ribosomal peptide synthetase 998
  • RSS
  • YouTube
  • Linkedin
  • Facebook