Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNAJC19 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00131118-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DNAJC19 protein.
  • Immunogen:
  • DNAJC19 (NP_660304.1, 1 a.a. ~ 116 a.a) full-length human protein.
  • Sequence:
  • MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DNAJC19 MaxPab polyclonal antibody. Western Blot analysis of DNAJC19 expression in K-562.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DNAJC19 expression in transfected 293T cell line (H00131118-T01) by DNAJC19 MaxPab polyclonal antibody.

    Lane1:DNAJC19 transfected lysate(12.76 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DNAJC19
  • Gene Alias:
  • TIM14,TIMM14
  • Gene Description:
  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • Other Designations:
  • homolog of yeast TIM14,translocase of the inner mitochondrial membrane 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook