OSR1 monoclonal antibody (M10), clone 1G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OSR1.
Immunogen
OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — OSR1
-
Disease
-
Publication Reference
-
Decreased KLHL3 expression is involved in the pathogenesis of pseudohypoaldosteronism type II caused by cullin 3 mutation in vivo.
Yoshida S, Araki Y, Mori T, Sasaki E, Kasagi Y, Isobe K, Susa K, Inoue Y, Bomont P, Okado T, Rai T, Uchida S, Sohara E.
Clinical and Experimental Nephrology 2018 Jun; [Epub].
Application:WB-Ti, Mouse, Mouse kidney.
-
Metformin increases urinary sodium excretion by reducing phosphorylation of the sodium-chloride cotransporter.
Hashimoto H, Nomura N, Shoda W, Isobe K, Kikuchi H, Yamamoto K, Fujimaru T, Ando F, Mori T, Okado T, Rai T, Uchida S, Sohara E.
Metabolism: Clinical and Experimental 2018 Aug; 85:23.
Application:WB-Ti, Mouse, Mouse kidneys.
-
Impaired degradation of medullary WNK4 in the kidneys of KLHL2 knockout mice.
Kasagi Y, Takahashi D, Aida T, Nishida H, Nomura N, Zeniya M, Mori T, Sasaki E, Ando F, Rai T, Uchida S, Sohara E.
Amino Acids 2017 Apr; 487(2):368.
Application:WB-Ti, Mouse, Mouse kidney.
-
WNK4 is the major WNK kinase positively regulating NCC in the mouse kidney.
Takahashi D, Mori T, Nomura N, Khan MZ, Araki Y, Zeniya M, Sohara E, Rai T, Sasaki S, Uchida S.
Bioscience Reports 2014 May; 34(3):e00107.
Application:WB-Ti, Mouse, Kidney.
-
Decreased KLHL3 expression is involved in the pathogenesis of pseudohypoaldosteronism type II caused by cullin 3 mutation in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com