ACMSD polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACMSD polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ACMSD expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ACMSD.
Immunogen
ACMSD (NP_612199, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag.
Sequence
SHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACMSD polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ACMSD expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACMSD
Entrez GeneID
130013GeneBank Accession#
NM_138326Protein Accession#
NP_612199Gene Name
ACMSD
Gene Alias
-
Gene Description
aminocarboxymuconate semialdehyde decarboxylase
Omim ID
608889Gene Ontology
HyperlinkGene Summary
The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM
Other Designations
2-amino-3-carboxymuconate-6-semialdehyde decarboxylase|OTTHUMP00000162500
-
Pathway
-
Publication Reference
-
Alpha-Amino-Beta-Carboxy-Muconate-Semialdehyde Decarboxylase Controls Dietary Niacin Requirements for NAD+ Synthesis.
Palzer L, Bader JJ, Angel F, Witzel M, Blaser S, McNeil A, Wandersee MK, Leu NA, Lengner CJ, Cho CE, Welch KD, Kirkland JB, Meyer RG, Meyer-Ficca ML.
Cell Reports 2018 Oct; 25(5):1359.
Application：WB-Ti, Mouse, Mouse livers.
-
Characterization of the Kynurenine Pathway in Human Neurons.
Guillemin GJ, Cullen KM, Lim CK, Smythe GA, Garner B, Kapoor V, Takikawa O, Brew BJ.
Journal of Neuroscience 2007 Nov; 27(47):12884.
Application：IF, Human, Human neurons, SK-N-SH cells.
-
Alpha-Amino-Beta-Carboxy-Muconate-Semialdehyde Decarboxylase Controls Dietary Niacin Requirements for NAD+ Synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com