Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TBN (Human) Recombinant Protein (P01)

  • Catalog # : H00129685-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TBN full-length ORF ( AAH33728.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00129685-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TAF8
  • Gene Alias:
  • 43,FLJ32821,II,TAF,TAFII43,TBN
  • Gene Description:
  • TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
  • Gene Summary:
  • This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016392,TAF(II)43,TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50 kD,TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa,TBP-associated factor 8,TBP-associated factor TAFII43,TBP-associa
  • RSS
  • YouTube
  • Linkedin
  • Facebook