TBN (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TBN full-length ORF ( AAH33728.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAF8
Entrez GeneID
129685GeneBank Accession#
BC033728.1Protein Accession#
AAH33728.1Gene Name
TAF8
Gene Alias
43, FLJ32821, II, TAF, TAFII43, TBN
Gene Description
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Omim ID
609514Gene Ontology
HyperlinkGene Summary
This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000016392|TAF(II)43|TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50 kD|TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa|TBP-associated factor 8|TBP-associated factor TAFII43|TBP-associa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com