Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TBN purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00129685-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TBN protein.
  • Immunogen:
  • TBN (AAH33728.1, 1 a.a. ~ 174 a.a) full-length human protein.
  • Sequence:
  • MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TAF8 expression in transfected 293T cell line (H00129685-T02) by TAF8 MaxPab polyclonal antibody.

    Lane 1: TBN transfected lysate(19.14 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TAF8
  • Gene Alias:
  • 43,FLJ32821,II,TAF,TAFII43,TBN
  • Gene Description:
  • TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
  • Gene Summary:
  • This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016392,TAF(II)43,TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50 kD,TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa,TBP-associated factor 8,TBP-associated factor TAFII43,TBP-associa
  • RSS
  • YouTube
  • Linkedin
  • Facebook