Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCRLB monoclonal antibody (M01), clone 2F8

  • Catalog # : H00127943-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FCRLB.
  • Immunogen:
  • FCRLB (NP_689591.1, 89 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DSLASCKAGAASPILGCRTRAECQSGCDMKRLAWSLFLSSFPRPSWTRSPCPTFQKAPLPPPRGHTASSPPPLVCGSARSPRGKQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00127943-M01
    Western Blot detection against Immunogen (35.2 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FCRLB monoclonal antibody (M01), clone 2F8. Western Blot analysis of FCRLB expression in IMR-32.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FCRLB expression in transfected 293T cell line by FCRLB monoclonal antibody (M01), clone 2F8.

    Lane 1: FCRLB transfected lysate (Predicted MW: 32.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FCRLB is 3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • FCRLB
  • Gene Alias:
  • FCRL2,FCRLM2,FCRLY,FLJ31052,FREB-2,FcRY,RP11-474I16.6
  • Gene Description:
  • Fc receptor-like B
  • Gene Summary:
  • FCRL2 belongs to the Fc receptor family. Fc receptors are involved in phagocytosis, antibody-dependent cell cytotoxicity, immediate hypersensitivity, and transcytosis of immunoglobulins via their ability to bind immunoglobulin (Ig) constant regions (Chikaev et al., 2005 [PubMed 15676285]).[supplied by OMIM
  • Other Designations:
  • Fc receptor like 2,Fc receptor-like and mucin-like 2,OTTHUMP00000158814
  • RSS
  • YouTube
  • Linkedin
  • Facebook