FCRLB monoclonal antibody (M01), clone 2F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FCRLB monoclonal antibody (M01), clone 2F8. Western Blot analysis of FCRLB expression in IMR-32.
Western Blot (Transfected lysate)
Western Blot analysis of FCRLB expression in transfected 293T cell line by FCRLB monoclonal antibody (M01), clone 2F8.
Lane 1: FCRLB transfected lysate (Predicted MW: 32.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FCRLB is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FCRLB.
Immunogen
FCRLB (NP_689591.1, 89 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSLASCKAGAASPILGCRTRAECQSGCDMKRLAWSLFLSSFPRPSWTRSPCPTFQKAPLPPPRGHTASSPPPLVCGSARSPRGKQE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (44)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FCRLB monoclonal antibody (M01), clone 2F8. Western Blot analysis of FCRLB expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of FCRLB expression in transfected 293T cell line by FCRLB monoclonal antibody (M01), clone 2F8.
Lane 1: FCRLB transfected lysate (Predicted MW: 32.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FCRLB is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — FCRLB
Entrez GeneID
127943GeneBank Accession#
NM_152378.1Protein Accession#
NP_689591.1Gene Name
FCRLB
Gene Alias
FCRL2, FCRLM2, FCRLY, FLJ31052, FREB-2, FcRY, RP11-474I16.6
Gene Description
Fc receptor-like B
Omim ID
609251Gene Ontology
HyperlinkGene Summary
FCRL2 belongs to the Fc receptor family. Fc receptors are involved in phagocytosis, antibody-dependent cell cytotoxicity, immediate hypersensitivity, and transcytosis of immunoglobulins via their ability to bind immunoglobulin (Ig) constant regions (Chikaev et al., 2005 [PubMed 15676285]).[supplied by OMIM
Other Designations
Fc receptor like 2|Fc receptor-like and mucin-like 2|OTTHUMP00000158814
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com