UHMK1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UHMK1 full-length ORF ( AAH26046.1, 1 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEGLC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
64.5
Interspecies Antigen Sequence
Mouse (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UHMK1
Entrez GeneID
127933GeneBank Accession#
BC026046.1Protein Accession#
AAH26046.1Gene Name
UHMK1
Gene Alias
KIS, Kist
Gene Description
U2AF homology motif (UHM) kinase 1
Omim ID
608849Gene Ontology
HyperlinkOther Designations
KIS protein kinase|OTTHUMP00000029529|kinase interacting stathmin|kinase interacting with leukemia-associated gene (stathmin)
-
Interactome
-
Disease
-
Publication Reference
-
Expression of kinase interacting with stathmin (KIS, UHMK1) in human brain and lymphoblasts: effects of schizophrenia and genotype.
Bristow GC, Lane TA, Walker M, Chen L, Sei Y, Hyde TM, Kleinman JE, Harrison PJ, Eastwood SL.
Brain Research 2009 Dec; 1301:197.
Application:WB-Re, Recombinant protein.
-
Expression of kinase interacting with stathmin (KIS, UHMK1) in human brain and lymphoblasts: effects of schizophrenia and genotype.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com