SYT2 monoclonal antibody (M01), clone 1G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SYT2 monoclonal antibody (M01), clone 1G10. Western Blot analysis of SYT2 expression in human kidney.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SYT2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SYT2.
Immunogen
SYT2 (NP_796376, 311 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SYT2 monoclonal antibody (M01), clone 1G10. Western Blot analysis of SYT2 expression in human kidney.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SYT2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SYT2
Entrez GeneID
127833GeneBank Accession#
NM_177402Protein Accession#
NP_796376Gene Name
SYT2
Gene Alias
SytII
Gene Description
synaptotagmin II
Omim ID
600104Gene Ontology
HyperlinkGene Summary
Synaptotagmins, like SYT2, are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (Hilbush and Morgan, 1994 [PubMed 8058779]).[supplied by OMIM
Other Designations
OTTHUMP00000038803|OTTHUMP00000038804|synaptotagmin 2
-
Interactome
-
Publication Reference
-
Synaptotagmin 2 is ectopically overexpressed in excitatory presynapses of a widely used CaMKΙΙα-Cre mouse line.
Ken Matsuura, Haytham M A Mohamed, Mohieldin M M Youssef, Yutaka Yoshida, Tadashi Yamamoto.
iScience 2022 Aug; 25(8):104692.
Application：WB-Ce, Mouse, Mouse brain.
-
Synaptotagmin 2 is ectopically overexpressed in excitatory presynapses of a widely used CaMKΙΙα-Cre mouse line.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com