GJB4 monoclonal antibody (M01), clone 1E3-1C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GJB4 monoclonal antibody (M01), clone 1E3-1C12 Western Blot analysis of GJB4 expression in Hela ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 monoclonal antibody (M01), clone 1E3-1C12.
Lane 1: GJB4 transfected lysate(30 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GJB4 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (55 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GJB4.
Immunogen
GJB4 (AAH34709, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GJB4 monoclonal antibody (M01), clone 1E3-1C12 Western Blot analysis of GJB4 expression in Hela ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 monoclonal antibody (M01), clone 1E3-1C12.
Lane 1: GJB4 transfected lysate(30 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GJB4 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — GJB4
Entrez GeneID
127534GeneBank Accession#
BC034709Protein Accession#
AAH34709Gene Name
GJB4
Gene Alias
CX30.3, EKV, MGC21116
Gene Description
gap junction protein, beta 4, 30.3kDa
Gene Ontology
HyperlinkGene Summary
beta 4
Other Designations
OTTHUMP00000004185|connexin 30.3|gap junction protein, beta 4|gap junction protein, beta 4 (connexin 30.3)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com