Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B3GALT6 polyclonal antibody (A01)

  • Catalog # : H00126792-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant B3GALT6.
  • Immunogen:
  • B3GALT6 (NP_542172, 229 a.a. ~ 329 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00126792-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • B3GALT6 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of B3GALT6 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • B3GALT6
  • Gene Alias:
  • beta3GalT6
  • Gene Description:
  • UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6
  • Other Designations:
  • OTTHUMP00000001756,UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6,beta-1,3-galactosyltransferase-6
  • RSS
  • YouTube
  • Linkedin
  • Facebook