FLJ39501 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYP4F22 expression in transfected 293T cell line (H00126410-T01) by CYP4F22 MaxPab polyclonal antibody.
Lane 1: FLJ39501 transfected lysate(58.41 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FLJ39501 protein.
Immunogen
FLJ39501 (AAH69351, 1 a.a. ~ 531 a.a) full-length human protein.
Sequence
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYP4F22 expression in transfected 293T cell line (H00126410-T01) by CYP4F22 MaxPab polyclonal antibody.
Lane 1: FLJ39501 transfected lysate(58.41 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYP4F22
Entrez GeneID
126410GeneBank Accession#
BC069351Protein Accession#
AAH69351Gene Name
CYP4F22
Gene Alias
FLJ39501, LI3
Gene Description
cytochrome P450, family 4, subfamily F, polypeptide 22
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19 and encodes an enzyme thought to play a role in the 12(R)-lipoxygenase pathway. Mutations in this gene are the cause of ichthyosis lamellar type 3. [provided by RefSeq
Other Designations
cytochrome P450, family 2, subfamily E, polypeptide 2 homolog
-
Interactome
-
Publication Reference
-
CYP4F22 is highly expressed at the site and timing of onset of keratinization during skin development.
Sasaki K, Akiyama M, Yanagi T, Sakai K, Miyamura Y, Sato M, Shimizu H.
Journal of Dermatological Science 2011 Dec; 65(2):156.
Application：IF, WB, Human, Human skin, HaCaT cells.
-
CYP4F22 is highly expressed at the site and timing of onset of keratinization during skin development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com