Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

JSRP1 monoclonal antibody (M02), clone 6A9

  • Catalog # : H00126306-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant JSRP1.
  • Immunogen:
  • JSRP1 (NP_653217.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00126306-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged JSRP1 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • JSRP1
  • Gene Alias:
  • FLJ32416,JP-45
  • Gene Description:
  • junctional sarcoplasmic reticulum protein 1
  • Gene Summary:
  • The sarcoplasmic reticulum (SR) is an intracellular membrane compartment that controls intracellular calcium concentration and therefore plays a role in excitation-contraction coupling. In mouse skeletal muscle, Jp45 interacts with key proteins involved in excitation-contraction coupling at the SR (Anderson et al., 2003 [PubMed 12871958]).[supplied by OMIM
  • Other Designations:
  • 2310032K21Rik,homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45,skeletal muscle sarcoplasmic reticulum protein JP-45
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook