OSCAR (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OSCAR partial ORF ( NP_996553.1, 175 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.54
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — OSCAR
Entrez GeneID
126014GeneBank Accession#
NM_206817Protein Accession#
NP_996553.1Gene Name
OSCAR
Gene Alias
MGC33613, PIGR3
Gene Description
osteoclast associated, immunoglobulin-like receptor
Omim ID
606862Gene Ontology
HyperlinkGene Summary
Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000067452|osteoclast associated receptor OSCAR-S1|osteoclast associated receptor OSCAR-S2|osteoclast-associated receptor|polymeric immunoglobulin receptor 3
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com