Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OSCAR (Human) Recombinant Protein (Q01)

  • Catalog # : H00126014-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OSCAR partial ORF ( NP_996553.1, 175 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.54
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00126014-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • OSCAR
  • Gene Alias:
  • MGC33613,PIGR3
  • Gene Description:
  • osteoclast associated, immunoglobulin-like receptor
  • Gene Summary:
  • Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067452,osteoclast associated receptor OSCAR-S1,osteoclast associated receptor OSCAR-S2,osteoclast-associated receptor,polymeric immunoglobulin receptor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook