MRPL10 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MRPL10 expression in transfected 293T cell line (H00124995-T01) by MRPL10 MaxPab polyclonal antibody.
Lane 1: MRPL10 transfected lysate(28.82 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPL10 protein.
Immunogen
MRPL10 (AAH15904, 1 a.a. ~ 261 a.a) full-length human protein.
Sequence
MAAAVAGMLRGGLLPQAGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKIFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSPLQHQPLQLTTLLDQYIREQREKDSVMSANGKPDPDTVPDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MRPL10 expression in transfected 293T cell line (H00124995-T01) by MRPL10 MaxPab polyclonal antibody.
Lane 1: MRPL10 transfected lysate(28.82 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPL10
Entrez GeneID
124995GeneBank Accession#
BC015904Protein Accession#
AAH15904Gene Name
MRPL10
Gene Alias
L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Gene Description
mitochondrial ribosomal protein L10
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq
Other Designations
39S ribosomal protein L10, mitochondrial
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com