SENP8 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SENP8 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP8 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T01) by SENP8 MaxPab polyclonal antibody.
Lane 1: SENP8 transfected lysate(24.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SENP8 protein.
Immunogen
SENP8 (NP_660205.2, 1 a.a. ~ 212 a.a) full-length human protein.
Sequence
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SENP8 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP8 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T01) by SENP8 MaxPab polyclonal antibody.
Lane 1: SENP8 transfected lysate(24.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SENP8
Entrez GeneID
123228GeneBank Accession#
NM_145204.2Protein Accession#
NP_660205.2Gene Name
SENP8
Gene Alias
DEN1, HsT17512, NEDP1, PRSC2
Gene Description
SUMO/sentrin specific peptidase family member 8
Omim ID
608659Gene Ontology
HyperlinkGene Summary
NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM
Other Designations
NEDD8-specific protease 1|SUMO/sentrin specific protease family member 8|deneddylase 1|protease, cysteine, 2 (NEDD8 specific)|sentrin/SUMO-specific protease SENP8
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com