SENP8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T02) by SENP8 MaxPab polyclonal antibody.
Lane 1: SENP8 transfected lysate(23.32 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SENP8 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SENP8 protein.
Immunogen
SENP8 (NP_660205.2, 1 a.a. ~ 212 a.a) full-length human protein.
Sequence
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T02) by SENP8 MaxPab polyclonal antibody.
Lane 1: SENP8 transfected lysate(23.32 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SENP8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SENP8
Entrez GeneID
123228GeneBank Accession#
NM_145204.2Protein Accession#
NP_660205.2Gene Name
SENP8
Gene Alias
DEN1, HsT17512, NEDP1, PRSC2
Gene Description
SUMO/sentrin specific peptidase family member 8
Omim ID
608659Gene Ontology
HyperlinkGene Summary
NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM
Other Designations
NEDD8-specific protease 1|SUMO/sentrin specific protease family member 8|deneddylase 1|protease, cysteine, 2 (NEDD8 specific)|sentrin/SUMO-specific protease SENP8
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com