Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNAJC24 (Human) Recombinant Protein (P01)

  • Catalog # : H00120526-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DNAJC24 full-length ORF (1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.68
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DNAJC24
  • Gene Alias:
  • DPH4,JJJ3,ZCSL3
  • Gene Description:
  • DnaJ (Hsp40) homolog, subfamily C, member 24
  • Gene Summary:
  • Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM
  • Other Designations:
  • 1700030A21Rik,DPH4 homolog (JJJ3, S. cerevisiae),DPH4, JJJ3 homolog,zinc finger, CSL domain containing 3,zinc finger, CSL-type containing 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook