Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMP21 (Human) Recombinant Protein (Q01)

  • Catalog # : H00118856-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MMP21 partial ORF ( NP_671724.1, 374 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00118856-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MMP21
  • Gene Alias:
  • -
  • Gene Description:
  • matrix metallopeptidase 21
  • Gene Summary:
  • This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling,and disease processes, such as asthma and metastasis. The encoded protein may play an important role in embryogenesis, particularly in neuronal cells, as well as in lymphocyte development and survival. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020708,matrix metalloproteinase 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook