EXOSC6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EXOSC6 partial ORF ( NP_478126, 3 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.78
Interspecies Antigen Sequence
Mouse (90); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EXOSC6
Entrez GeneID
118460GeneBank Accession#
NM_058219Protein Accession#
NP_478126Gene Name
EXOSC6
Gene Alias
EAP4, MTR3, Mtr3p, hMtr3p, p11
Gene Description
exosome component 6
Omim ID
606490Gene Ontology
HyperlinkGene Summary
This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. [provided by RefSeq
Other Designations
Mtr3 (mRNA transport regulator 3)-homolog|OTTHUMP00000174902|homolog of yeast mRNA transport regulator 3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com