Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPR62 polyclonal antibody (A01)

  • Catalog # : H00118442-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GPR62.
  • Immunogen:
  • GPR62 (NP_543141, 314 a.a. ~ 368 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00118442-A01
    Western Blot detection against Immunogen (32.16 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GPR62 polyclonal antibody (A01), Lot # 050926JC01. Western Blot analysis of GPR62 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GPR62
  • Gene Alias:
  • GPCR8,KPG_005,MGC26943
  • Gene Description:
  • G protein-coupled receptor 62
  • Gene Summary:
  • G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM
  • Other Designations:
  • G-protein coupled receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook