RFFL monoclonal antibody (M01), clone 3A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody (M01), clone 3A4.
Lane 1: RFFL transfected lysate(36.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RFFL is 0.03 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RFFL over-expressed 293 cell line, cotransfected with RFFL Validated Chimera RNAi ( Cat # H00117584-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RFFL monoclonal antibody (M01), clone 3A4 (Cat # H00117584-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RFFL.
Immunogen
RFFL (NP_001017368, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQRE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody (M01), clone 3A4.
Lane 1: RFFL transfected lysate(36.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RFFL is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RFFL over-expressed 293 cell line, cotransfected with RFFL Validated Chimera RNAi ( Cat # H00117584-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RFFL monoclonal antibody (M01), clone 3A4 (Cat # H00117584-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RFFL
Entrez GeneID
117584GeneBank Accession#
NM_001017368Protein Accession#
NP_001017368Gene Name
RFFL
Gene Alias
RIFIFYLIN, RNF189, RNF34L
Gene Description
ring finger and FYVE-like domain containing 1
Omim ID
609735Gene Ontology
HyperlinkOther Designations
FYVE-RING finger protein SAKURA|fring|rififylin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com