Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALS2CR19 monoclonal antibody (M01), clone 8D7

  • Catalog # : H00117583-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ALS2CR19.
  • Immunogen:
  • ALS2CR19 (NP_689739, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • PARD3B
  • Gene Alias:
  • ALS2CR19,MGC16131,PAR3B,PAR3L,PAR3LC,PAR3beta,Par3Lb
  • Gene Description:
  • par-3 partitioning defective 3 homolog B (C. elegans)
  • Other Designations:
  • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19,par-3 partitioning defective 3 homolog B,partitioning-defective 3-beta,partitioning-defective 3-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook