TWIST2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TWIST2 full-length ORF ( AAH33168, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.34
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TWIST2
Entrez GeneID
117581GeneBank Accession#
BC033168Protein Accession#
AAH33168Gene Name
TWIST2
Gene Alias
DERMO1, MGC117334, bHLHa39
Gene Description
twist homolog 2 (Drosophila)
Omim ID
607556Gene Ontology
HyperlinkGene Summary
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Twist. It is thought that during osteoblast development this protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype. [provided by RefSeq
Other Designations
dermis-expressed protein 1|twist homolog 2|twist-related bHLH protein Dermo1
-
Interactome
-
Publication Reference
-
Twist2 Reduced NLRP3-Induced Inflammation of Infantile Pneumonia via Regulation of Mitochondrial Permeability Transition by FOXO1.
Niu Ding, Dian Liu, Xiaojun Duan, Jin Zhang, Song Ma, Yanping Chen.
International Archives of Allergy and Immunology 2022 Jun; 180(13):1098.
Application：Sub, Mouse, Mouse lung.
-
Twist2 Reduced NLRP3-Induced Inflammation of Infantile Pneumonia via Regulation of Mitochondrial Permeability Transition by FOXO1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com