TWIST2 monoclonal antibody (M01), clone 3C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TWIST2.
Immunogen
TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M01), clone 3C8.
Lane 1: TWIST2 transfected lysate(18.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TWIST2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — TWIST2
Entrez GeneID
117581GeneBank Accession#
BC033168Protein Accession#
AAH33168Gene Name
TWIST2
Gene Alias
DERMO1, MGC117334, bHLHa39
Gene Description
twist homolog 2 (Drosophila)
Omim ID
607556Gene Ontology
HyperlinkGene Summary
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Twist. It is thought that during osteoblast development this protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype. [provided by RefSeq
Other Designations
dermis-expressed protein 1|twist homolog 2|twist-related bHLH protein Dermo1
-
Interactome
-
Publication Reference
-
Twist2-driven chromatin remodeling governs the postnatal maturation of dermal fibroblasts.
Jin Yong Kim, Minji Park, Jungyoon Ohn, Rho Hyun Seong, Jin Ho Chung, Kyu Han Kim, Seong Jin Jo, Ohsang Kwon.
Cell Reports 2022 May; 39(7):110821.
Application:WB-Ce, Mouse, Mouse dermal.
-
Twist2 Promotes CD8 + T-cell Differentiation by Repressing ThPOK Expression.
Sunsook Hwang, Changjin Lee, Kyungsoo Park, Sangwook Oh, Shin Jeon, Byeonggeun Kang, Yehyun Kim, Jaehak Oh, Sung Ho Jeon, Masanobu Satake, Ichiro Taniuchi, Ho Lee, Rho Hyun Seong.
Cell Death and Differentiation 2020 Nov; 27(11):3053.
Application:WB, Human, CD4 SP, CD8 SP, DP cells.
-
Aurora B induces epithelial-mesenchymal transition by stabilizing Snail1 to promote basal-like breast cancer metastasis.
Zhang J, Lin X, Wu L, Huang JJ, Jiang WQ, Kipps TJ, Zhang S.
Oncogene 2020 Mar; 39(12):2550.
Application:WB-Tr, Human, MCF-7 cells.
-
RNAi screen identifies essential regulators of human brain metastasis-initiating cells.
Singh M, Venugopal C, Tokar T, Brown KR, McFarlane N, Bakhshinyan D, Vijayakumar T, Manoranjan B, Mahendram S, Vora P, Qazi M, Dhillon M, Tong A, Durrer K, Murty N, Hallet R, Hassell JA, Kaplan DR, Cutz JC, Jurisica I, Moffat J, Singh SK.
Acta Neuropathologica 2017 Aug; 134(6):923.
Application:IHC-P, Human, Human lung cancer.
-
Expression of Twist2 is controlled by T-cell receptor signaling and determines the survival and death of thymocytes.
Oh S, Oh J, Lee C, Oh S, Jeon S, Choi J, Hwang S, Lee Y, Lee H, Seong RH.
Cell Death and Differentiation 2016 Nov; 23(11):1804.
Application:ChIP, WB-Ce, Mouse, Thymocytes, 16610D9 cells.
-
Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV.
Rodrigues IS, Lavorato-Rocha AM, de M Maia B, Stiepcich MM, de Carvalho FM, Baiocchi G, Soares FA, Rocha RM.
British Journal of Cancer 2013 Jul; 109(1):184.
Application:IHC-P, Human, Vulvar squamous cell carcinoma.
-
Twist2 is a valuable prognostic biomarker for colorectal cancer.
Yu H, Jin GZ, Liu K, Dong H, Yu H, Duan JC, Li Z, Dong W, Cong WM, Yang JH.
World Journal of Gastroenterology 2013 Apr; 19(15):2404.
Application:IHC-P, Human, Human colorectal cancer.
-
Significance of heterogeneous Twist2 expression in human breast cancers.
Mao Y, Zhang N, Xu J, Ding Z, Zong R, Liu Z.
PLoS One 2012 Oct; 7(10):e48178.
Application:IF, IHC-P, WB-Ti, WB-Tr, Human, Human breast cancers, MCF-7 cells.
-
Discordant Gene Expression Signatures and Related Phenotypic Differences in Lamin A-and A/C-Related Hutchinson-Gilford Progeria Syndrome (HGPS).
Plasilova M, Chattopadhyay C, Ghosh A, Wenzel F, Demougin P, Noppen C, Schaub N, Szinnai G, Terracciano L, Heinimann K.
PLoS One 2011 Jun; 6(6):e21433.
Application:IHC, Human, Skin, Liver.
-
Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal.
Fang X, Cai Y, Liu J, Wang Z, Wu Q, Zhang Z, Yang CJ, Yuan L, Ouyang G.
Oncogene 2011 May; 30:4707.
Application:IF, IHC-P, WB-Ti, Human, Breast cancer, MCF-10A, MCF-7 cells.
-
Interleukin 17 acts in synergy with B cell-activating factor to influence B cell biology and the pathophysiology of systemic lupus erythematosus.
Doreau A, Belot A, Bastid J, Riche B, Trescol-Biemont MC, Ranchin B, Fabien N, Cochat P, Pouteil-Noble C, Trolliet P, Durieu I, Tebib J, Kassai B, Ansieau S, Puisieux A, Eliaou JF, Bonnefoy-Berard N.
Nature Immunology 2009 Jul; 10(7):778.
Application:WB-Ce, Mouse, B cells, B104 cells, BL41 cells.
-
Molecular mechanism of transforming growth factor-beta-mediated inhibition of growth arrest and differentiation in a myoblast cell line.
Murakami M, Ohkuma M, Nakamura M.
Development, Growth & Differentiation 2008 Jan; 50(2):121.
Application:IF, Mouse, C2C12 cells.
-
Twist2-driven chromatin remodeling governs the postnatal maturation of dermal fibroblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com