Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2D1B (Human) Recombinant Protein (P01)

  • Catalog # : H00117157-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SH2D1B full-length ORF ( NP_444512.2, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00117157-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SH2D1B
  • Gene Alias:
  • EAT2
  • Gene Description:
  • SH2 domain containing 1B
  • Gene Summary:
  • By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000029531,SH2 domain-containing molecule EAT2
  • RSS
  • YouTube
  • Linkedin
  • Facebook