Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPL39L (Human) Recombinant Protein (P01)

  • Catalog # : H00116832-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RPL39L full-length ORF ( AAH12328, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.35
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00116832-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RPL39L
  • Gene Alias:
  • RPL39L1
  • Gene Description:
  • ribosomal protein L39-like
  • Gene Summary:
  • This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. [provided by RefSeq
  • Other Designations:
  • ribosomal protein L39-like 1,ribosomal protein L39-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook