RPL39L (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RPL39L full-length ORF ( AAH12328, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.35
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RPL39L
Entrez GeneID
116832GeneBank Accession#
BC012328Protein Accession#
AAH12328Gene Name
RPL39L
Gene Alias
RPL39L1
Gene Description
ribosomal protein L39-like
Omim ID
607547Gene Ontology
HyperlinkGene Summary
This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. [provided by RefSeq
Other Designations
ribosomal protein L39-like 1|ribosomal protein L39-like protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com