C1orf19 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
C1orf19 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf19 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of TSEN15 expression in transfected 293T cell line (H00116461-T02) by TSEN15 MaxPab polyclonal antibody.
Lane 1: C1orf19 transfected lysate(18.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C1orf19 protein.
Immunogen
C1orf19 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein.
Sequence
MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C1orf19 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf19 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of TSEN15 expression in transfected 293T cell line (H00116461-T02) by TSEN15 MaxPab polyclonal antibody.
Lane 1: C1orf19 transfected lysate(18.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TSEN15
Entrez GeneID
116461GeneBank Accession#
NM_052965.1Protein Accession#
NP_443197.1Gene Name
TSEN15
Gene Alias
C1orf19, sen15
Gene Description
tRNA splicing endonuclease 15 homolog (S. cerevisiae)
Omim ID
608756Gene Ontology
HyperlinkGene Summary
tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM
Other Designations
OTTHUMP00000033516|tRNA splicing endonuclease 15
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com