Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSEN15 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00116461-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TSEN15 protein.
  • Immunogen:
  • TSEN15 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein.
  • Sequence:
  • MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • C1orf19 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf19 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSEN15 expression in transfected 293T cell line (H00116461-T02) by TSEN15 MaxPab polyclonal antibody.

    Lane 1: TSEN15 transfected lysate(18.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of TSEN15 transfected lysate using anti-TSEN15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TSEN15 MaxPab mouse polyclonal antibody (B01) (H00116461-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TSEN15
  • Gene Alias:
  • C1orf19,sen15
  • Gene Description:
  • tRNA splicing endonuclease 15 homolog (S. cerevisiae)
  • Gene Summary:
  • tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000033516,tRNA splicing endonuclease 15
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook