Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1orf19 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00116461-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human C1orf19 protein.
  • Immunogen:
  • C1orf19 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein.
  • Sequence:
  • MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSEN15 expression in transfected 293T cell line (H00116461-T01) by TSEN15 MaxPab polyclonal antibody.

    Lane 1: C1orf19 transfected lysate(18.81 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TSEN15
  • Gene Alias:
  • C1orf19,sen15
  • Gene Description:
  • tRNA splicing endonuclease 15 homolog (S. cerevisiae)
  • Gene Summary:
  • tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000033516,tRNA splicing endonuclease 15
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook