Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CMTM5 monoclonal antibody (M02), clone 2B10

  • Catalog # : H00116173-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CMTM5.
  • Immunogen:
  • CMTM5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • CMTM5
  • Gene Alias:
  • CKLFSF5,FLJ37521
  • Gene Description:
  • CKLF-like MARVEL transmembrane domain containing 5
  • Gene Summary:
  • This gene belongs to the chemokine-like factor gene superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • chemokine-like factor super family 5,chemokine-like factor superfamily 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook