Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CMTM5 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00116173-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CMTM5 protein.
  • Immunogen:
  • CMTM5 (NP_612469.1, 1 a.a. ~ 156 a.a) full-length human protein.
  • Sequence:
  • MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CMTM5 MaxPab polyclonal antibody. Western Blot analysis of CMTM5 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CMTM5 expression in transfected 293T cell line (H00116173-T01) by CMTM5 MaxPab polyclonal antibody.

    Lane 1: CMTM5 transfected lysate(17.16 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CMTM5
  • Gene Alias:
  • CKLFSF5,FLJ37521
  • Gene Description:
  • CKLF-like MARVEL transmembrane domain containing 5
  • Gene Summary:
  • This gene belongs to the chemokine-like factor gene superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • chemokine-like factor super family 5,chemokine-like factor superfamily 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook