Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHACTR3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00116154-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PHACTR3 partial ORF ( NP_542403.1, 92 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00116154-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PHACTR3
  • Gene Alias:
  • C20orf101,H17739,MGC117178,SCAPIN1,SCAPININ
  • Gene Description:
  • phosphatase and actin regulator 3
  • Gene Summary:
  • The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031424,OTTHUMP00000174466,OTTHUMP00000174467,phosphatase and actin regulator 3, isoform 1,scaffold-associated PP1 inhibiting protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook