Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHACTR3 monoclonal antibody (M02), clone 4A5

  • Catalog # : H00116154-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PHACTR3.
  • Immunogen:
  • PHACTR3 (NP_542403.1, 92 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00116154-M02
    Western Blot detection against Immunogen (35.42 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PHACTR3 expression in transfected 293T cell line by PHACTR3 monoclonal antibody (M02), clone 4A5.

    Lane 1: PHACTR3 transfected lysate(51.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PHACTR3 is 1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • PHACTR3
  • Gene Alias:
  • C20orf101,H17739,MGC117178,SCAPIN1,SCAPININ
  • Gene Description:
  • phosphatase and actin regulator 3
  • Gene Summary:
  • The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031424,OTTHUMP00000174466,OTTHUMP00000174467,phosphatase and actin regulator 3, isoform 1,scaffold-associated PP1 inhibiting protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook