PHACTR3 monoclonal antibody (M02), clone 4A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PHACTR3 expression in transfected 293T cell line by PHACTR3 monoclonal antibody (M02), clone 4A5.
Lane 1: PHACTR3 transfected lysate(51.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHACTR3 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PHACTR3.
Immunogen
PHACTR3 (NP_542403.1, 92 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PHACTR3 expression in transfected 293T cell line by PHACTR3 monoclonal antibody (M02), clone 4A5.
Lane 1: PHACTR3 transfected lysate(51.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHACTR3 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — PHACTR3
Entrez GeneID
116154GeneBank Accession#
NM_080672Protein Accession#
NP_542403.1Gene Name
PHACTR3
Gene Alias
C20orf101, H17739, MGC117178, SCAPIN1, SCAPININ
Gene Description
phosphatase and actin regulator 3
Omim ID
608725Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000031424|OTTHUMP00000174466|OTTHUMP00000174467|phosphatase and actin regulator 3, isoform 1|scaffold-associated PP1 inhibiting protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com