FOXP4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FOXP4 partial ORF ( NP_001012426.1, 586 a.a. - 679 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FOXP4
Entrez GeneID
116113GeneBank Accession#
NM_001012426Protein Accession#
NP_001012426.1Gene Name
FOXP4
Gene Alias
FLJ40908, FLJ44184, hFKHLA
Gene Description
forkhead box P4
Omim ID
608924Gene Ontology
HyperlinkGene Summary
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000016374|OTTHUMP00000039784|OTTHUMP00000043412|OTTHUMP00000043536|fork head-related protein like A|winged-helix repressor FOXP4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com