CTHRC1 monoclonal antibody (M05), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CTHRC1.
Immunogen
CTHRC1 (NP_612464, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CTHRC1 expression in transfected 293T cell line by CTHRC1 monoclonal antibody (M05), clone 1G12.
Lane 1: CTHRC1 transfected lysate(26.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CTHRC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CTHRC1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CTHRC1
Entrez GeneID
115908GeneBank Accession#
NM_138455Protein Accession#
NP_612464Gene Name
CTHRC1
Gene Alias
-
Gene Description
collagen triple helix repeat containing 1
Omim ID
610635Gene Ontology
HyperlinkGene Summary
CTHRC1 is specifically expressed in vascular calcifications of carotid artery lesions and may contribute to vascular remodeling of injured arteries (Pyagay et al., 2005 [PubMed 15618538]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Collagen Triple Helix Repeat Containing-1 (CTHRC1) Expression in Invasive Ductal Carcinoma of the Breast: The Impact on Prognosis and Correlation to Clinicopathologic Features.
Kim JH, Baek TH, Yim HS, Kim KH, Jeong SH, Kang HB, Oh SS, Lee HG, Kim JW, Kim KD.
Pathology Oncology Research 2013 Oct; 19(4):731.
Application:IHC-P, Human, Breast cancer.
-
Collagen Triple Helix Repeat Containing-1 (CTHRC1) Expression in Invasive Ductal Carcinoma of the Breast: The Impact on Prognosis and Correlation to Clinicopathologic Features.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com